SCOPe 2.08: Domain d1hlpa1: 1hlp A:21-162

Lineage for d1hlpa1 (1hlp A:21-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Haloarcula marismortui [TaxId:2238] [51855] (6 PDB entries)

8. Domain d1hlpa1: 1hlp A:21-162 [30145]
   Other proteins in same PDB: d1hlpa2, d1hlpb2
   complexed with nad

Details for d1hlpa1

PDB Entry: 1hlp, 3.2 Å

PDB Description: structural features stabilizing halophilic malate dehydrogenase from an archaebacterium

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1hlpa1:

Sequence; same for both SEQRES and ATOM records:

>d1hlpa1 c.2.1.5 (A:21-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvigfg

Timeline for d1hlpa1:

• d1hlpa1 first appeared (with stable ids) in SCOP 1.55
  
• d1hlpa1 appears in SCOPe 2.07