Lineage for d1bdma1 (1bdm A:0-154)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20534Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (3 proteins)
  6. 20578Protein Malate dehydrogenase [51849] (7 species)
  7. 20609Species Thermus flavus [TaxId:274] [51854] (2 PDB entries)
  8. 20610Domain d1bdma1: 1bdm A:0-154 [30137]
    Other proteins in same PDB: d1bdma2, d1bdmb2

Details for d1bdma1

PDB Entry: 1bdm (more details), 1.8 Å

PDB Description: the structure at 1.8 angstroms resolution of a single site mutant (t189i) of malate dehydrogenase from thermus flavus with increased enzymatic activity

SCOP Domain Sequences for d1bdma1:

Sequence, based on SEQRES records: (download)

>d1bdma1 c.2.1.5 (A:0-154) Malate dehydrogenase {Thermus flavus}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpdvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnftam

Sequence, based on observed residues (ATOM records): (download)

>d1bdma1 c.2.1.5 (A:0-154) Malate dehydrogenase {Thermus flavus}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpdvafkdadyallvgaaprlqvngkifteqgralaevakkdvkvlvv
gnpantnaliayknapglnprnftam

SCOP Domain Coordinates for d1bdma1:

Click to download the PDB-style file with coordinates for d1bdma1.
(The format of our PDB-style files is described here.)

Timeline for d1bdma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bdma2