Lineage for d7mdhc1 (7mdh C:23-197)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) 
Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins) 
Protein Malate dehydrogenase [51849] (7 species) 
Species Sorghum (Sorghum vulgare), chloroplast [TaxId:4558] [51851] (1 PDB entry) 
Domain d7mdhc1: 7mdh C:23-197 [30132]
Other proteins in same PDB: d7mdha2, d7mdhb2, d7mdhc2, d7mdhd2
Details for d7mdhc1
PDB Entry: 7mdh (more details), 2.4 Å
PDB Description: structural basis for light acitvation of a chloroplast enzyme. the structure of sorghum nadp-malate dehydrogenase in its oxidized form
SCOP Domain Sequences for d7mdhc1:
Sequence, based on SEQRES records: (download)
>d7mdhc1 c.2.1.5 (C:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast}
dcfgvfcttydlkaedktkswkklvniavsgaagmisnhllfklasgevfgqdqpialkl
lgsersfqalegvameledslypllrevsigidpyevfedvdwalligakprgpgmeraa
lldingqifadqgkalnavasknvkvlvvgnpcntnaliclknapdipaknfhal
Sequence, based on observed residues (ATOM records): (download)
>d7mdhc1 c.2.1.5 (C:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast}
dcfgvfcttswkklvniavsgaagmisnhllfklasgevfgqdqpialkllgsersfqal
egvameledslypllrevsigidpyevfedvdwalligakprgpgmeraalldingqifa
dqgkalnavasknvkvlvvgnpcntnaliclknapdipaknfhal
SCOP Domain Coordinates for d7mdhc1:
Click to download the PDB-style file with coordinates for d7mdhc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7mdhc1:
View in 3D
