Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins) |
Protein Malate dehydrogenase [51849] (11 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries) |
Domain d4mdhb1: 4mdh B:1-154 [30129] Other proteins in same PDB: d4mdha2, d4mdhb2 complexed with nad, sul |
PDB Entry: 4mdh (more details), 2.5 Å
SCOP Domain Sequences for d4mdhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mdhb1 c.2.1.5 (B:1-154) Malate dehydrogenase {Pig (Sus scrofa)} sepirvlvtgaagqiaysllysigngsvfgkdqpiilvllditpmmgvldgvlmelqdca lpllkdviatdkeeiafkdldvailvgsmprrdgmerkdllkanvkifkcqgaaldkyak ksvkvivvgnpantncltasksapsipkenfscl
Timeline for d4mdhb1: