SCOPe 2.06: Domain d4x4yc_: 4x4y C:

Lineage for d4x4yc_ (4x4y C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4x4yc_: 4x4y C: [301270]
   Other proteins in same PDB: d4x4yb_, d4x4yd_
   automated match to d2q20b_
   mutant

Details for d4x4yc_

PDB Entry: 4x4y, 2.49 Å

PDB Description: retrofitting antibodies with stabilizing mutations. herceptin scfv mutant k30d/s52d.

PDB Compounds: (C:) Human Variable Heavy Chain of Herceptin

SCOPe Domain Sequences for d4x4yc_:

Sequence, based on SEQRES records:

>d4x4yc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfniddtyihwvrqapgkglewvariyptngytrya
dsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvs

Sequence, based on observed residues (ATOM records):

>d4x4yc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfniddtyihwvrqapgkglewvariyptngytrya
dsvkgrftisadtskntaylqmnslraedtavyycsrwyamdvwgqgtlvtvs

Timeline for d4x4yc_:

• d4x4yc_ is new in SCOPe 2.06-stable
  
• d4x4yc_ last appears in SCOPe 2.07