Lineage for d5mdhb1 (5mdh B:1-154)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388231Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins)
  6. 388323Protein Malate dehydrogenase [51849] (11 species)
  7. 388371Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries)
  8. 388379Domain d5mdhb1: 5mdh B:1-154 [30127]
    Other proteins in same PDB: d5mdha2, d5mdhb2
    complexed with mak, nad

Details for d5mdhb1

PDB Entry: 5mdh (more details), 2.4 Å

PDB Description: crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution

SCOP Domain Sequences for d5mdhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mdhb1 c.2.1.5 (B:1-154) Malate dehydrogenase {Pig (Sus scrofa)}
sepirvlvtgaagqiaysllysigngsvfgkdqpiilvllditpmmgvldgvlmelqdca
lpllkdviatdkeeiafkdldvailvgsmprrdgmerkdllkanvkifkcqgaaldkyak
ksvkvivvgnpantncltasksapsipkenfscl

SCOP Domain Coordinates for d5mdhb1:

Click to download the PDB-style file with coordinates for d5mdhb1.
(The format of our PDB-style files is described here.)

Timeline for d5mdhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mdhb2