Lineage for d4x4xa_ (4x4x A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033447Domain d4x4xa_: 4x4x A: [301267]
    Other proteins in same PDB: d4x4xb_, d4x4xd_
    automated match to d2q20b_
    mutant

Details for d4x4xa_

PDB Entry: 4x4x (more details), 2.25 Å

PDB Description: retrofitting antibodies with stabilizing mutations. herceptin scfv mutant.
PDB Compounds: (A:) Human Variable Heavy Chain of Herceptin

SCOPe Domain Sequences for d4x4xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x4xa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytrya
dsvkgrftisadtskntaylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvs

SCOPe Domain Coordinates for d4x4xa_:

Click to download the PDB-style file with coordinates for d4x4xa_.
(The format of our PDB-style files is described here.)

Timeline for d4x4xa_: