SCOP 1.69: Domain d5mdha1: 5mdh A:1-154

Lineage for d5mdha1 (5mdh A:1-154)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Malate dehydrogenase [51849] (12 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries)

8. Domain d5mdha1: 5mdh A:1-154 [30126]
   Other proteins in same PDB: d5mdha2, d5mdhb2

Details for d5mdha1

PDB Entry: 5mdh, 2.4 Å

PDB Description: crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution

SCOP Domain Sequences for d5mdha1:

Sequence; same for both SEQRES and ATOM records:

>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa)}
sepirvlvtgaagqiaysllysigngsvfgkdqpiilvllditpmmgvldgvlmelqdca
lpllkdviatdkeeiafkdldvailvgsmprrdgmerkdllkanvkifkcqgaaldkyak
ksvkvivvgnpantncltasksapsipkenfscl

Timeline for d5mdha1:

• d5mdha1 first appeared (with stable ids) in SCOP 1.55
  
• d5mdha1 appears in SCOP 1.67
  
• d5mdha1 appears in SCOP 1.71
  
• d5mdha1 appears in the current release, SCOPe 2.08