SCOPe 2.07: Domain d4wura2: 4wur A:62-319

Lineage for d4wura2 (4wur A:62-319)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (5 species)
   not a true protein

7. Species Human coronavirus emc [TaxId:1263720] [311464] (1 PDB entry)

8. Domain d4wura2: 4wur A:62-319 [301220]
   Other proteins in same PDB: d4wura1, d4wurb_
   automated match to d4p16a2
   complexed with ipa, zn

Details for d4wura2

PDB Entry: 4wur, 3.16 Å

PDB Description: the crystal structure of the mers-cov papain-like protease (c111s) with human ubiquitin

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d4wura2:

Sequence; same for both SEQRES and ATOM records:

>d4wura2 d.3.1.23 (A:62-319) automated matches {Human coronavirus emc [TaxId: 1263720]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnnsylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyss

Timeline for d4wura2:

• d4wura2 first appeared in SCOPe 2.06