![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
![]() | Protein automated matches [310868] (6 species) not a true protein |
![]() | Species Human coronavirus emc [TaxId:1263720] [311464] (1 PDB entry) |
![]() | Domain d4wura2: 4wur A:62-319 [301220] Other proteins in same PDB: d4wura1, d4wurb_ automated match to d4p16a2 complexed with ipa, zn |
PDB Entry: 4wur (more details), 3.16 Å
SCOPe Domain Sequences for d4wura2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wura2 d.3.1.23 (A:62-319) automated matches {Human coronavirus emc [TaxId: 1263720]} adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnnsylnavimtld llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts dwkckvtdvlfpgqkyss
Timeline for d4wura2: