SCOPe 2.06: Domain d4wczd_: 4wcz D:

Lineage for d4wczd_ (4wcz D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [226680] (3 PDB entries)

8. Domain d4wczd_: 4wcz D: [301123]
   Other proteins in same PDB: d4wczc2, d4wczf2
   automated match to d5c9ga_

Details for d4wczd_

PDB Entry: 4wcz, 1.82 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase from novosphingobium aromaticivorans

PDB Compounds: (D:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4wczd_:

Sequence; same for both SEQRES and ATOM records:

>d4wczd_ c.14.1.0 (D:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
slrlerdgavarllidradrrnafsldmwqrlpellaeasgddalrvlvvksanggafca
gadiaellankddaafhaanqqainraqyelarfrlptvamvegdcigggcgialacdmr
iaapaarfgitpaklglvyplhdvkllvdlvgpgqarrlmftgglidaneahriglvell
gesedalvgqlatvssfstqaiksfvrrvldgqvaddadslrvfasafegadfregtgaf
lekrppvf

Timeline for d4wczd_:

• d4wczd_ is new in SCOPe 2.06-stable
  
• d4wczd_ appears in SCOPe 2.07
  
• d4wczd_ appears in the current release, SCOPe 2.08