| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) ![]() |
| Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
| Protein S-adenosylhomocystein hydrolase [51845] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [51846] (2 PDB entries) |
| Domain d1a7ab1: 1a7a B:190-352 [30105] Other proteins in same PDB: d1a7aa2, d1a7ab2 complexed with adc, nah |
PDB Entry: 1a7a (more details), 2.8 Å
SCOP Domain Sequences for d1a7ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7ab1 c.2.1.4 (B:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens)}
dnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpina
lqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighfdveidvk
wlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamg
Timeline for d1a7ab1: