Lineage for d1a7ab1 (1a7a B:190-352)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388130Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 388187Protein S-adenosylhomocystein hydrolase [51845] (2 species)
  7. 388188Species Human (Homo sapiens) [TaxId:9606] [51846] (2 PDB entries)
  8. 388191Domain d1a7ab1: 1a7a B:190-352 [30105]
    Other proteins in same PDB: d1a7aa2, d1a7ab2
    complexed with adc, nah

Details for d1a7ab1

PDB Entry: 1a7a (more details), 2.8 Å

PDB Description: structure of human placental s-adenosylhomocysteine hydrolase: determination of a 30 selenium atom substructure from data at a single wavelength

SCOP Domain Sequences for d1a7ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7ab1 c.2.1.4 (B:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens)}
dnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpina
lqaamegyevttmdeacqegnifvtttgcidiilgrhfeqmkddaivcnighfdveidvk
wlnenavekvnikpqvdryrlkngrriillaegrlvnlgcamg

SCOP Domain Coordinates for d1a7ab1:

Click to download the PDB-style file with coordinates for d1a7ab1.
(The format of our PDB-style files is described here.)

Timeline for d1a7ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a7ab2