Lineage for d1pjba1 (1pjb A:136-303)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20482Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (8 proteins)
  6. 20500Protein L-alanine dehydrogenase [51843] (1 species)
  7. 20501Species Phormidium lapideum [TaxId:32060] [51844] (3 PDB entries)
  8. 20504Domain d1pjba1: 1pjb A:136-303 [30103]
    Other proteins in same PDB: d1pjba2

Details for d1pjba1

PDB Entry: 1pjb (more details), 2.1 Å

PDB Description: l-alanine dehydrogenase

SCOP Domain Sequences for d1pjba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjba1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum}
agrlsvqfgarflerqqggrgvllggvpgvkpgkvvilgggvvgteaakmavglgaqvqi
fdinverlsyletlfgsrvellysnsaeietavaeadlligavlvpgrrapilvpaslve
qmrtgsvivdvavdqggcvetlhptshtqptyevfgvvhygvpnmpga

SCOP Domain Coordinates for d1pjba1:

Click to download the PDB-style file with coordinates for d1pjba1.
(The format of our PDB-style files is described here.)

Timeline for d1pjba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pjba2