Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein L-alanine dehydrogenase [51843] (1 species) |
Species Phormidium lapideum [TaxId:32060] [51844] (3 PDB entries) |
Domain d1saya1: 1say A:136-303 [30102] Other proteins in same PDB: d1saya2 complexed with pyr |
PDB Entry: 1say (more details), 2.1 Å
SCOP Domain Sequences for d1saya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1saya1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum} agrlsvqfgarflerqqggrgvllggvpgvkpgkvvilgggvvgteaakmavglgaqvqi fdinverlsyletlfgsrvellysnsaeietavaeadlligavlvpgrrapilvpaslve qmrtgsvivdvavdqggcvetlhptshtqptyevfgvvhygvpnmpga
Timeline for d1saya1: