Lineage for d1saya1 (1say A:136-303)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308772Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 308796Protein L-alanine dehydrogenase [51843] (1 species)
  7. 308797Species Phormidium lapideum [TaxId:32060] [51844] (3 PDB entries)
  8. 308799Domain d1saya1: 1say A:136-303 [30102]
    Other proteins in same PDB: d1saya2
    complexed with pyr

Details for d1saya1

PDB Entry: 1say (more details), 2.1 Å

PDB Description: l-alanine dehydrogenase complexed with pyruvate

SCOP Domain Sequences for d1saya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1saya1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum}
agrlsvqfgarflerqqggrgvllggvpgvkpgkvvilgggvvgteaakmavglgaqvqi
fdinverlsyletlfgsrvellysnsaeietavaeadlligavlvpgrrapilvpaslve
qmrtgsvivdvavdqggcvetlhptshtqptyevfgvvhygvpnmpga

SCOP Domain Coordinates for d1saya1:

Click to download the PDB-style file with coordinates for d1saya1.
(The format of our PDB-style files is described here.)

Timeline for d1saya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1saya2