SCOPe 2.07: Domain d2dldb1: 2dld B:104-300

Lineage for d2dldb1 (2dld B:104-300)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein D-lactate dehydrogenase [51841] (1 species)

7. Species Lactobacillus helveticus [TaxId:1587] [51842] (3 PDB entries)

8. Domain d2dldb1: 2dld B:104-300 [30100]
   Other proteins in same PDB: d2dlda2, d2dldb2
   complexed with nai, oxm

Details for d2dldb1

PDB Entry: 2dld, 2.7 Å

PDB Description: d-lactate dehydrogenase complexed with nadh and oxamate

PDB Compounds: (B:) d-lactate dehydrogenase

SCOPe Domain Sequences for d2dldb1:

Sequence; same for both SEQRES and ATOM records:

>d2dldb1 c.2.1.4 (B:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}
pnaiaehaaiqaarvlrqdkrmdekmakrdlrwaptigrevrdqvvgvvgtghigqvfmr
imegfgakviaydifknpelekkgyyvdslddlykqadvislhvpdvpanvhmindksia
emkdgvvivncsrgrlvdtdavirgldsgkifgfvmdtyedevgvfnkdwegkefpdkrl
adlidrpnvlvtphtaf

Timeline for d2dldb1:

• d2dldb1 first appeared (with stable ids) in SCOP 1.55
  
• d2dldb1 appears in SCOPe 2.06
  
• d2dldb1 appears in the current release, SCOPe 2.08