Lineage for d2dldb1 (2dld B:104-300)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238994Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 239002Protein D-lactate dehydrogenase [51841] (1 species)
  7. 239003Species Lactobacillus helveticus [TaxId:1587] [51842] (3 PDB entries)
  8. 239011Domain d2dldb1: 2dld B:104-300 [30100]
    Other proteins in same PDB: d2dlda2, d2dldb2
    complexed with nad, oxm

Details for d2dldb1

PDB Entry: 2dld (more details), 2.7 Å

PDB Description: d-lactate dehydrogenase complexed with nadh and oxamate

SCOP Domain Sequences for d2dldb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dldb1 c.2.1.4 (B:104-300) D-lactate dehydrogenase {Lactobacillus helveticus}
pnaiaehaaiqaarvlrqdkrmdekmakrdlrwaptigrevrdqvvgvvgtghigqvfmr
imegfgakviaydifknpelekkgyyvdslddlykqadvislhvpdvpanvhmindksia
emkdgvvivncsrgrlvdtdavirgldsgkifgfvmdtyedevgvfnkdwegkefpdkrl
adlidrpnvlvtphtaf

SCOP Domain Coordinates for d2dldb1:

Click to download the PDB-style file with coordinates for d2dldb1.
(The format of our PDB-style files is described here.)

Timeline for d2dldb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dldb2