SCOP 1.63: Domain d1psda1: 1psd A:108-295

Lineage for d1psda1 (1psd A:108-295)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Phosphoglycerate dehydrogenase [51839] (1 species)
   has additional C-terminal domain of the ferredoxin fold

7. Species Escherichia coli [TaxId:562] [51840] (1 PDB entry)

8. Domain d1psda1: 1psd A:108-295 [30097]
   Other proteins in same PDB: d1psda2, d1psda3, d1psdb2, d1psdb3

Details for d1psda1

PDB Entry: 1psd, 2.75 Å

PDB Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase

SCOP Domain Sequences for d1psda1:

Sequence; same for both SEQRES and ATOM records:

>d1psda1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli}
ntrsvaelvigelllllrgvpeanakahrgvwnklaagsfeargkklgiigyghigtqlg
ilaeslgmyvyfydienklplgnatqvqhlsdllnmsdvvslhvpenpstknmmgakeis
lmkpgsllinasrgtvvdipalcdalaskhlagaaidvfptepatnsdpftsplcefdnv
lltphigg

Timeline for d1psda1:

• d1psda1 first appeared (with stable ids) in SCOP 1.55
  
• d1psda1 appears in SCOP 1.61
  
• d1psda1 appears in SCOP 1.65
  
• d1psda1 appears in the current release, SCOPe 2.08