Lineage for d1dxy_1 (1dxy 101-299)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308772Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 308773Protein D-2-hydroxyisocaproate dehydrogenase [51835] (1 species)
  7. 308774Species Lactobacillus casei [TaxId:1582] [51836] (1 PDB entry)
  8. 308775Domain d1dxy_1: 1dxy 101-299 [30094]
    Other proteins in same PDB: d1dxy_2
    complexed with coi, nad, so4

Details for d1dxy_1

PDB Entry: 1dxy (more details), 1.9 Å

PDB Description: structure of d-2-hydroxyisocaproate dehydrogenase

SCOP Domain Sequences for d1dxy_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxy_1 c.2.1.4 (101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei}
spaaiaefaltdtlyllrnmgkvqaqlqagdyekagtfigkelgqqtvgvmgtghigqva
iklfkgfgakviaydpypmkgdhpdfdyvsledlfkqsdvidlhvpgieqnthiineaaf
nlmkpgaivintarpnlidtqamlsnlksgklagvgidtyeyetedllnlakhgsfkdpl
wdellgmpnvvlsphiayy

SCOP Domain Coordinates for d1dxy_1:

Click to download the PDB-style file with coordinates for d1dxy_1.
(The format of our PDB-style files is described here.)

Timeline for d1dxy_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dxy_2