Lineage for d1dxy_1 (1dxy 101-299)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66721Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (9 proteins)
  6. 66722Protein D-2-hydroxyisocaproate dehydrogenase [51835] (1 species)
  7. 66723Species Lactobacillus casei [TaxId:1582] [51836] (1 PDB entry)
  8. 66724Domain d1dxy_1: 1dxy 101-299 [30094]
    Other proteins in same PDB: d1dxy_2

Details for d1dxy_1

PDB Entry: 1dxy (more details), 1.9 Å

PDB Description: structure of d-2-hydroxyisocaproate dehydrogenase

SCOP Domain Sequences for d1dxy_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxy_1 c.2.1.4 (101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei}
spaaiaefaltdtlyllrnmgkvqaqlqagdyekagtfigkelgqqtvgvmgtghigqva
iklfkgfgakviaydpypmkgdhpdfdyvsledlfkqsdvidlhvpgieqnthiineaaf
nlmkpgaivintarpnlidtqamlsnlksgklagvgidtyeyetedllnlakhgsfkdpl
wdellgmpnvvlsphiayy

SCOP Domain Coordinates for d1dxy_1:

Click to download the PDB-style file with coordinates for d1dxy_1.
(The format of our PDB-style files is described here.)

Timeline for d1dxy_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dxy_2