SCOP 1.63: Domain d1qp8b1: 1qp8 B:83-263

Lineage for d1qp8b1 (1qp8 B:83-263)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Putative formate dehydrogenase [51833] (1 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [51834] (1 PDB entry)

8. Domain d1qp8b1: 1qp8 B:83-263 [30093]
   Other proteins in same PDB: d1qp8a2, d1qp8b2
   complexed with ndp

Details for d1qp8b1

PDB Entry: 1qp8, 2.8 Å

PDB Description: crystal structure of a putative formate dehydrogenase from pyrobaculum aerophilum

SCOP Domain Sequences for d1qp8b1:

Sequence; same for both SEQRES and ATOM records:

>d1qp8b1 c.2.1.4 (B:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum}
adavaefalalllapykriiqygekmkrgdygrdveipliqgekvavlglgeigtrvgki
laalgaqvrgfsrtpkegpwrftnsleealrearaavcalplnkhtrglvkyqhlalmae
davfvnvgraevldrdgvlrilkerpqfifasdvwwgrndfakdaeffslpnvvatpwva
g

Timeline for d1qp8b1:

• d1qp8b1 first appeared (with stable ids) in SCOP 1.55
  
• d1qp8b1 appears in SCOP 1.61
  
• d1qp8b1 appears in SCOP 1.65
  
• d1qp8b1 appears in the current release, SCOPe 2.08