Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein Putative formate dehydrogenase [51833] (1 species) |
Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [51834] (1 PDB entry) |
Domain d1qp8b1: 1qp8 B:83-263 [30093] Other proteins in same PDB: d1qp8a2, d1qp8b2 complexed with ndp |
PDB Entry: 1qp8 (more details), 2.8 Å
SCOP Domain Sequences for d1qp8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qp8b1 c.2.1.4 (B:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum} adavaefalalllapykriiqygekmkrgdygrdveipliqgekvavlglgeigtrvgki laalgaqvrgfsrtpkegpwrftnsleealrearaavcalplnkhtrglvkyqhlalmae davfvnvgraevldrdgvlrilkerpqfifasdvwwgrndfakdaeffslpnvvatpwva g
Timeline for d1qp8b1: