Lineage for d4ubue2 (4ubu E:269-391)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917965Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries)
  8. 2918047Domain d4ubue2: 4ubu E:269-391 [300925]
    Other proteins in same PDB: d4ubue3, d4ubug3, d4ubuh3
    automated match to d4wysa2
    complexed with coa, gol

Details for d4ubue2

PDB Entry: 4ubu (more details), 3 Å

PDB Description: structure of a modified c93s variant of the 3-ketoacyl-coa thiolase fada5 from m. tuberculosis in complex with coa
PDB Compounds: (E:) Acetyl-CoA acetyltransferase FadA5

SCOPe Domain Sequences for d4ubue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubue2 c.95.1.0 (E:269-391) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tprarivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlswarv
hepdmdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstgtii
eri

SCOPe Domain Coordinates for d4ubue2:

Click to download the PDB-style file with coordinates for d4ubue2.
(The format of our PDB-style files is described here.)

Timeline for d4ubue2: