Lineage for d1qp8a1 (1qp8 A:83-263)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175717Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (9 proteins)
  6. 175758Protein Putative formate dehydrogenase [51833] (1 species)
  7. 175759Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [51834] (1 PDB entry)
  8. 175760Domain d1qp8a1: 1qp8 A:83-263 [30092]
    Other proteins in same PDB: d1qp8a2, d1qp8b2

Details for d1qp8a1

PDB Entry: 1qp8 (more details), 2.8 Å

PDB Description: crystal structure of a putative formate dehydrogenase from pyrobaculum aerophilum

SCOP Domain Sequences for d1qp8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum}
adavaefalalllapykriiqygekmkrgdygrdveipliqgekvavlglgeigtrvgki
laalgaqvrgfsrtpkegpwrftnsleealrearaavcalplnkhtrglvkyqhlalmae
davfvnvgraevldrdgvlrilkerpqfifasdvwwgrndfakdaeffslpnvvatpwva
g

SCOP Domain Coordinates for d1qp8a1:

Click to download the PDB-style file with coordinates for d1qp8a1.
(The format of our PDB-style files is described here.)

Timeline for d1qp8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qp8a2