Lineage for d2nacb1 (2nac B:148-335)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20482Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (8 proteins)
  6. 20494Protein Formate dehydrogenase [51831] (1 species)
  7. 20495Species Pseudomonas sp., strain 101 [TaxId:306] [51832] (2 PDB entries)
  8. 20497Domain d2nacb1: 2nac B:148-335 [30089]
    Other proteins in same PDB: d2naca2, d2nacb2

Details for d2nacb1

PDB Entry: 2nac (more details), 1.8 Å

PDB Description: high resolution structures of holo and apo formate dehydrogenase

SCOP Domain Sequences for d2nacb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nacb1 c.2.1.4 (B:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101}
isvaehvvmmilslvrnylpshewarkggwniadcvshaydleamhvgtvaagriglavl
rrlapfdvhlhytdrhrlpesvekelnltwhatredmypvcdvvtlncplhpetehmind
etlklfkrgayivntargklcdrdavaralesgrlagyagdvwfpqpapkdhpwrtmpyn
gmtphisg

SCOP Domain Coordinates for d2nacb1:

Click to download the PDB-style file with coordinates for d2nacb1.
(The format of our PDB-style files is described here.)

Timeline for d2nacb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nacb2