Lineage for d1qkib1 (1qki B:11-199,B:435-449)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843727Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species)
  7. 2843728Species Human (Homo sapiens) [TaxId:9606] [51829] (1 PDB entry)
  8. 2843730Domain d1qkib1: 1qki B:11-199,B:435-449 [30081]
    Other proteins in same PDB: d1qkia2, d1qkib2, d1qkic2, d1qkid2, d1qkie2, d1qkif2, d1qkig2, d1qkih2
    complexed with goa, gol, nap

Details for d1qkib1

PDB Entry: 1qki (more details), 3 Å

PDB Description: x-ray structure of human glucose 6-phosphate dehydrogenase (variant canton r459l) complexed with structural nadp+
PDB Compounds: (B:) glucose-6-phosphate 1-dehydrogenase

SCOPe Domain Sequences for d1qkib1:

Sequence, based on SEQRES records: (download)

>d1qkib1 c.2.1.3 (B:11-199,B:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgy
arsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhl
gsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhissl
fredqiyriXdayerlildvfcgsq

Sequence, based on observed residues (ATOM records): (download)

>d1qkib1 c.2.1.3 (B:11-199,B:435-449) Glucose 6-phosphate dehydrogenase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hvcgiqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadirk
qsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfylal
pptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyriXda
yerlildvfcgsq

SCOPe Domain Coordinates for d1qkib1:

Click to download the PDB-style file with coordinates for d1qkib1.
(The format of our PDB-style files is described here.)

Timeline for d1qkib1: