Lineage for d1ofge1 (1ofg E:1-160,E:323-381)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20357Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)
  7. 20358Species Zymomonas mobilis [TaxId:542] [51826] (2 PDB entries)
  8. 20363Domain d1ofge1: 1ofg E:1-160,E:323-381 [30068]
    Other proteins in same PDB: d1ofga2, d1ofgb2, d1ofgc2, d1ofgd2, d1ofge2, d1ofgf2

Details for d1ofge1

PDB Entry: 1ofg (more details), 2.7 Å

PDB Description: glucose-fructose oxidoreductase

SCOP Domain Sequences for d1ofge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofge1 c.2.1.3 (E:1-160,E:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

SCOP Domain Coordinates for d1ofge1:

Click to download the PDB-style file with coordinates for d1ofge1.
(The format of our PDB-style files is described here.)

Timeline for d1ofge1: