SCOP 1.75: Domain d1ofgd1: 1ofg D:1-160,D:323-381

Lineage for d1ofgd1 (1ofg D:1-160,D:323-381)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)
Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries)
Domain d1ofgd1: 1ofg D:1-160,D:323-381 [30067]
Other proteins in same PDB: d1ofga2, d1ofgb2, d1ofgc2, d1ofgd2, d1ofge2, d1ofgf2

Details for d1ofgd1

PDB Entry: 1ofg (more details), 2.7 Å

PDB Description: glucose-fructose oxidoreductase

PDB Compounds: (D:) glucose-fructose oxidoreductase

SCOP Domain Sequences for d1ofgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofgd1 c.2.1.3 (D:1-160,D:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

SCOP Domain Coordinates for d1ofgd1:

Click to download the PDB-style file with coordinates for d1ofgd1.
(The format of our PDB-style files is described here.)

Timeline for d1ofgd1: