Lineage for d4rf1a1 (4rf1 A:1483-1542)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933406Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311426] (3 PDB entries)
  8. 2933407Domain d4rf1a1: 4rf1 A:1483-1542 [300658]
    Other proteins in same PDB: d4rf1a2, d4rf1b_
    automated match to d4p16a1
    complexed with 3cn, pgo, zn

Details for d4rf1a1

PDB Entry: 4rf1 (more details), 2.15 Å

PDB Description: Crystal structure of the Middle-East respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group P63)
PDB Compounds: (A:) ORF1ab protein

SCOPe Domain Sequences for d4rf1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rf1a1 d.15.1.0 (A:1483-1542) automated matches {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt

SCOPe Domain Coordinates for d4rf1a1:

Click to download the PDB-style file with coordinates for d4rf1a1.
(The format of our PDB-style files is described here.)

Timeline for d4rf1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rf1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4rf1b_