SCOPe 2.08: Domain d4rf0a2: 4rf0 A:1543-1801

Lineage for d4rf0a2 (4rf0 A:1543-1801)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)

7. Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311427] (3 PDB entries)

8. Domain d4rf0a2: 4rf0 A:1543-1801 [300657]
   Other proteins in same PDB: d4rf0a1, d4rf0b_
   automated match to d4p16a2
   complexed with 3cn, so4, zn

Details for d4rf0a2

PDB Entry: 4rf0, 2.8 Å

PDB Description: Crystal structure of the Middle-East respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group P6522)

PDB Compounds: (A:) ORF1ab protein

SCOPe Domain Sequences for d4rf0a2:

Sequence; same for both SEQRES and ATOM records:

>d4rf0a2 d.3.1.23 (A:1543-1801) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssd

Timeline for d4rf0a2:

• d4rf0a2 first appeared in SCOPe 2.06
  
• d4rf0a2 appears in SCOPe 2.07