SCOPe 2.08: Domain d1e5lb1: 1e5l B:2-124,B:392-450

Lineage for d1e5lb1 (1e5l B:2-124,B:392-450)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Saccharopine reductase [51817] (1 species)

7. Species Fungus (Magnaporthe grisea) [TaxId:148305] [51818] (3 PDB entries)

8. Domain d1e5lb1: 1e5l B:2-124,B:392-450 [30049]
   Other proteins in same PDB: d1e5la2, d1e5lb2

Details for d1e5lb1

PDB Entry: 1e5l, 2.4 Å

PDB Description: apo saccharopine reductase from magnaporthe grisea

PDB Compounds: (B:) saccharopine reductase

SCOPe Domain Sequences for d1e5lb1:

Sequence; same for both SEQRES and ATOM records:

>d1e5lb1 c.2.1.3 (B:2-124,B:392-450) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
eigXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckek
vva

Timeline for d1e5lb1:

• d1e5lb1 first appeared (with stable ids) in SCOP 1.55
  
• d1e5lb1 appears in SCOPe 2.07