Lineage for d1e5la1 (1e5l A:2-124,A:392-450)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2844136Protein Saccharopine reductase [51817] (1 species)
  7. 2844137Species Fungus (Magnaporthe grisea) [TaxId:148305] [51818] (3 PDB entries)
  8. 2844147Domain d1e5la1: 1e5l A:2-124,A:392-450 [30048]
    Other proteins in same PDB: d1e5la2, d1e5lb2

Details for d1e5la1

PDB Entry: 1e5l (more details), 2.4 Å

PDB Description: apo saccharopine reductase from magnaporthe grisea
PDB Compounds: (A:) saccharopine reductase

SCOPe Domain Sequences for d1e5la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5la1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
eigXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckek
vva

SCOPe Domain Coordinates for d1e5la1:

Click to download the PDB-style file with coordinates for d1e5la1.
(The format of our PDB-style files is described here.)

Timeline for d1e5la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e5la2