Lineage for d1e5qc1 (1e5q C:2-124,C:392-450)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2844136Protein Saccharopine reductase [51817] (1 species)
  7. 2844137Species Fungus (Magnaporthe grisea) [TaxId:148305] [51818] (3 PDB entries)
  8. 2844141Domain d1e5qc1: 1e5q C:2-124,C:392-450 [30042]
    Other proteins in same PDB: d1e5qa2, d1e5qb2, d1e5qc2, d1e5qd2, d1e5qe2, d1e5qf2, d1e5qg2, d1e5qh2
    complexed with ndp, shr

Details for d1e5qc1

PDB Entry: 1e5q (more details), 2.1 Å

PDB Description: ternary complex of saccharopine reductase from magnaporthe grisea, nadph and saccharopine
PDB Compounds: (C:) Saccharopine dehydrogenase [NADP(+), L-glutamate-forming]

SCOPe Domain Sequences for d1e5qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5qc1 c.2.1.3 (C:2-124,C:392-450) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
eigXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckek
vva

SCOPe Domain Coordinates for d1e5qc1:

Click to download the PDB-style file with coordinates for d1e5qc1.
(The format of our PDB-style files is described here.)

Timeline for d1e5qc1: