Lineage for d1e5qb1 (1e5q B:2-124,B:392-450)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20469Protein Saccharopine reductase [51817] (1 species)
  7. 20470Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51818] (3 PDB entries)
  8. 20473Domain d1e5qb1: 1e5q B:2-124,B:392-450 [30041]
    Other proteins in same PDB: d1e5qa2, d1e5qb2, d1e5qc2, d1e5qd2, d1e5qe2, d1e5qf2, d1e5qg2, d1e5qh2

Details for d1e5qb1

PDB Entry: 1e5q (more details), 2.1 Å

PDB Description: ternary complex of saccharopine reductase from magnaporthe grisea, nadph and saccharopine

SCOP Domain Sequences for d1e5qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5qb1 c.2.1.3 (B:2-124,B:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
eigXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckek
vva

SCOP Domain Coordinates for d1e5qb1:

Click to download the PDB-style file with coordinates for d1e5qb1.
(The format of our PDB-style files is described here.)

Timeline for d1e5qb1: