Lineage for d1brmc1 (1brm C:1-133,C:355-367)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20315Protein Aspartate beta-semialdehyde dehydrogenase [51813] (1 species)
  7. 20316Species Escherichia coli [TaxId:562] [51814] (1 PDB entry)
  8. 20319Domain d1brmc1: 1brm C:1-133,C:355-367 [30032]
    Other proteins in same PDB: d1brma2, d1brmb2, d1brmc2

Details for d1brmc1

PDB Entry: 1brm (more details), 2.5 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase from escherichia coli

SCOP Domain Sequences for d1brmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brmc1 c.2.1.3 (C:1-133,C:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli}
mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
dglnngirtfvggXaaeplrrmlrqla

SCOP Domain Coordinates for d1brmc1:

Click to download the PDB-style file with coordinates for d1brmc1.
(The format of our PDB-style files is described here.)

Timeline for d1brmc1: