SCOP 1.73: Domain d3gpdg1: 3gpd G:1-150,G:315-334

Lineage for d3gpdg1 (3gpd G:1-150,G:315-334)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51812] (1 PDB entry)

8. Domain d3gpdg1: 3gpd G:1-150,G:315-334 [30029]
   Other proteins in same PDB: d3gpdg2, d3gpdr2
   complexed with ips, nad, sps

Details for d3gpdg1

PDB Entry: 3gpd, 3.5 Å

PDB Description: twinning in crystals of human skeletal muscle d-glyceraldehyde-3- phosphate dehydrogenase

PDB Compounds: (G:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d3gpdg1:

Sequence; same for both SEQRES and ATOM records:

>d3gpdg1 c.2.1.3 (G:1-150,G:315-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens) [TaxId: 9606]}
gkvkvgvdgfgrigrlvtraafnsgkvdivaindpfidlhymvymfqydsthgkfhgtvk
aedgklvidgkaitifqerdpenikwgdagtayvvestgvfttmekagahlkggakrivi
sapsadapmfvmgvnhfkyanslkiisnasXnefgyservvdlmahmaske

Timeline for d3gpdg1:

• d3gpdg1 first appeared (with stable ids) in SCOP 1.55
  
• d3gpdg1 appears in SCOP 1.71
  
• d3gpdg1 appears in SCOP 1.75
  
• d3gpdg1 appears in the current release, SCOPe 2.08