![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [51812] (1 PDB entry) |
![]() | Domain d3gpdr1: 3gpd R:1-150,R:315-334 [30028] Other proteins in same PDB: d3gpdg2, d3gpdr2 complexed with nad, so4 |
PDB Entry: 3gpd (more details), 3.5 Å
SCOPe Domain Sequences for d3gpdr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gpdr1 c.2.1.3 (R:1-150,R:315-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens) [TaxId: 9606]} gkvkvgvdgfgrigrlvtraafnsgkvdivaindpfidlhymvymfqydsthgkfhgtvk aedgklvidgkaitifqerdpenikwgdagtayvvestgvfttmekagahlkggakrivi sapsadapmfvmgvnhfkyanslkiisnasXnefgyservvdlmahmaske
Timeline for d3gpdr1: