Lineage for d1szjr1 (1szj R:1-148,R:313-334)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175469Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
  6. 175557Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 175639Species Lobster (Palinurus versicolor) [51811] (5 PDB entries)
  8. 175645Domain d1szjr1: 1szj R:1-148,R:313-334 [30025]
    Other proteins in same PDB: d1szjg2, d1szjr2

Details for d1szjr1

PDB Entry: 1szj (more details), 2 Å

PDB Description: structure of holo-glyceraldehyde-3-phosphate-dehydrogenase from palinurus versicolor refined 2.0 angstrom resolution

SCOP Domain Sequences for d1szjr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szjr1 c.2.1.3 (R:1-148,R:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

SCOP Domain Coordinates for d1szjr1:

Click to download the PDB-style file with coordinates for d1szjr1.
(The format of our PDB-style files is described here.)

Timeline for d1szjr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szjr2