Lineage for d1szjg1 (1szj G:1-148,G:313-334)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20369Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 20431Species Lobster (Palinurus versicolor) [51811] (3 PDB entries)
  8. 20436Domain d1szjg1: 1szj G:1-148,G:313-334 [30024]
    Other proteins in same PDB: d1szjg2, d1szjr2

Details for d1szjg1

PDB Entry: 1szj (more details), 2 Å

PDB Description: structure of holo-glyceraldehyde-3-phosphate-dehydrogenase from palinurus versicolor refined 2.0 angstrom resolution
PDB Compounds: (G:)

SCOP Domain Sequences for d1szjg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1szjg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

SCOP Domain Coordinates for d1szjg1:

Click to download the PDB-style file with coordinates for d1szjg1.
(The format of our PDB-style files is described here.)

Timeline for d1szjg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1szjg2