SCOPe 2.08: Domain d4ph0e2: 4ph0 E:133-206

Lineage for d4ph0e2 (4ph0 E:133-206)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Bovine leukemia virus [TaxId:11901] [273638] (1 PDB entry)

8. Domain d4ph0e2: 4ph0 E:133-206 [300222]
   Other proteins in same PDB: d4ph0a1, d4ph0b1, d4ph0c1, d4ph0d1, d4ph0e1, d4ph0f1
   automated match to d4ph0a2

Details for d4ph0e2

PDB Entry: 4ph0, 2.75 Å

PDB Description: capsid protein from bovine leukemia virus

PDB Compounds: (E:) BLV capsid

SCOPe Domain Sequences for d4ph0e2:

Sequence; same for both SEQRES and ATOM records:

>d4ph0e2 a.28.3.0 (E:133-206) automated matches {Bovine leukemia virus [TaxId: 11901]}
wstivqgpaesyvefvnrlqisladnlpdgvpkepiidslsyanankecqqilqgrglva
apvgqklqacahwa

Timeline for d4ph0e2:

• d4ph0e2 first appeared in SCOPe 2.06
  
• d4ph0e2 appears in SCOPe 2.07