![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
![]() | Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51809] (5 PDB entries) |
![]() | Domain d1a7ka1: 1a7k A:1-165,A:335-358 [30008] Other proteins in same PDB: d1a7ka2, d1a7kb2, d1a7kc2, d1a7kd2 complexed with nad, po4 |
PDB Entry: 1a7k (more details), 2.8 Å
SCOPe Domain Sequences for d1a7ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7ka1 c.2.1.3 (A:1-165,A:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]} apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr ymaakdaass
Timeline for d1a7ka1: