Class b: All beta proteins [48724] (177 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (16 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255543] (3 PDB entries) |
Domain d4oopa_: 4oop A: [300066] automated match to d4ooqa_ complexed with dup, mg |
PDB Entry: 4oop (more details), 1.5 Å
SCOPe Domain Sequences for d4oopa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oopa_ b.85.4.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pspffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyar iaprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpd vvevddldetvrg
Timeline for d4oopa_: