Lineage for d1ggab1 (1gga B:1-164,B:334-358)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308576Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)
  7. 308707Species Trypanosoma brucei brucei, glycosome [TaxId:5702] [51808] (1 PDB entry)
  8. 308709Domain d1ggab1: 1gga B:1-164,B:334-358 [30003]
    Other proteins in same PDB: d1ggaa2, d1ggab2, d1ggao2, d1ggap2, d1ggaq2, d1ggar2
    complexed with nad, so4

Details for d1ggab1

PDB Entry: 1gga (more details), 3.2 Å

PDB Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma brucei determined from laue data

SCOP Domain Sequences for d1ggab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggab1 c.2.1.3 (B:1-164,B:334-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma brucei brucei, glycosome}
tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnasXnewgyshrvvdlvrh
maardraakl

SCOP Domain Coordinates for d1ggab1:

Click to download the PDB-style file with coordinates for d1ggab1.
(The format of our PDB-style files is described here.)

Timeline for d1ggab1: