SCOP 1.65: Domain d1cf2q1: 1cf2 Q:1-138,Q:304-336

Lineage for d1cf2q1 (1cf2 Q:1-138,Q:304-336)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)
Species Archaeon Methanothermus fervidus [TaxId:2180] [51807] (1 PDB entry)
Domain d1cf2q1: 1cf2 Q:1-138,Q:304-336 [29995]
Other proteins in same PDB: d1cf2o2, d1cf2p2, d1cf2q2, d1cf2r2

Details for d1cf2q1

PDB Entry: 1cf2 (more details), 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus

SCOP Domain Sequences for d1cf2q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf2q1 c.2.1.3 (Q:1-138,Q:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus}
mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
nslsnyeesygkdytrvvXivpenvdavrailemeedkyksinktnkamnil

SCOP Domain Coordinates for d1cf2q1:

Click to download the PDB-style file with coordinates for d1cf2q1.
(The format of our PDB-style files is described here.)

Timeline for d1cf2q1: