Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein automated matches [310890] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [311406] (3 PDB entries) |
Domain d4o4lf2: 4o4l F:77-378 [299944] Other proteins in same PDB: d4o4la1, d4o4la2, d4o4lb1, d4o4lb2, d4o4lc1, d4o4lc2, d4o4ld1, d4o4ld2, d4o4le_, d4o4lf1 automated match to d3tiia2 complexed with ca, ep, gdp, gtp, mes, mg, pou |
PDB Entry: 4o4l (more details), 2.2 Å
SCOPe Domain Sequences for d4o4lf2:
Sequence, based on SEQRES records: (download)
>d4o4lf2 d.142.1.10 (F:77-378) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d4o4lf2 d.142.1.10 (F:77-378) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnltderevflaaynrrregregnvwiakssaga kgegilisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniyl yregvlrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdal nttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievnga pacaqklyaelcqgivdvaissvfplaptsifikl
Timeline for d4o4lf2: