SCOPe 2.08: Domain d4o2bf1: 4o2b F:1-76

Lineage for d4o2bf1 (4o2b F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)

8. Domain d4o2bf1: 4o2b F:1-76 [299925]
   Other proteins in same PDB: d4o2ba1, d4o2ba2, d4o2bb1, d4o2bb2, d4o2bc1, d4o2bc2, d4o2bd1, d4o2bd2, d4o2be_, d4o2bf2
   automated match to d3tiia1
   complexed with acp, ca, gdp, gol, gtp, imd, loc, mes, mg, peg

Details for d4o2bf1

PDB Entry: 4o2b, 2.3 Å

PDB Description: Tubulin-Colchicine complex

PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d4o2bf1:

Sequence; same for both SEQRES and ATOM records:

>d4o2bf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d4o2bf1:

• d4o2bf1 first appeared in SCOPe 2.06
  
• d4o2bf1 appears in SCOPe 2.07