Lineage for d1b7go1 (1b7g O:1-138,O:301-340)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118495Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (12 species)
  7. 118501Species Archaeon Sulfolobus solfataricus [TaxId:2287] [51806] (1 PDB entry)
  8. 118502Domain d1b7go1: 1b7g O:1-138,O:301-340 [29992]
    Other proteins in same PDB: d1b7go2, d1b7gq2

Details for d1b7go1

PDB Entry: 1b7g (more details), 2.05 Å

PDB Description: glyceraldehyde 3-phosphate dehydrogenase

SCOP Domain Sequences for d1b7go1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus}
mvnvavngygtigkrvadaiikqpdmklvgvaktspnyeafiahrrgiriyvpqqsikkf
eesgipvagtvedliktsdivvdttpngvgaqykpiylqlqrnaifqggekaevadisfs
alcnynealgkkyirvvsXesivvpenidairasmklmsaedsmritneslgilkgyli

SCOP Domain Coordinates for d1b7go1:

Click to download the PDB-style file with coordinates for d1b7go1.
(The format of our PDB-style files is described here.)

Timeline for d1b7go1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7go2