SCOP 1.61: Domain d1hdgo1: 1hdg O:1-148,O:313-331

Lineage for d1hdgo1 (1hdg O:1-148,O:313-331)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)

7. Species Thermotoga maritima [TaxId:243274] [51805] (1 PDB entry)

8. Domain d1hdgo1: 1hdg O:1-148,O:313-331 [29990]
   Other proteins in same PDB: d1hdgo2, d1hdgq2

Details for d1hdgo1

PDB Entry: 1hdg, 2.5 Å

PDB Description: the crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium thermotoga maritima at 2.5 angstroms resolution

SCOP Domain Sequences for d1hdgo1:

Sequence; same for both SEQRES and ATOM records:

>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima}
arvaingfgrigrlvyriiyerknpdievvaindltdtktlahllkydsvhkkfpgkvey
tenslivdgkeikvfaepdpsklpwkdlgvdfviestgvfrnrekaelhlqagakkviit
apakgeditvvigcnedqlkpehtiiscasXneygysnrvvdtlelllkm

Timeline for d1hdgo1:

• d1hdgo1 first appeared (with stable ids) in SCOP 1.55
  
• d1hdgo1 appears in SCOP 1.59
  
• d1hdgo1 appears in SCOP 1.63
  
• d1hdgo1 appears in the current release, SCOPe 2.08