Lineage for d1hdgo1 (1hdg O:1-148,O:313-331)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20369Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 20446Species Thermotoga maritima [TaxId:243274] [51805] (1 PDB entry)
  8. 20447Domain d1hdgo1: 1hdg O:1-148,O:313-331 [29990]
    Other proteins in same PDB: d1hdgo2, d1hdgq2

Details for d1hdgo1

PDB Entry: 1hdg (more details), 2.5 Å

PDB Description: the crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium thermotoga maritima at 2.5 angstroms resolution

SCOP Domain Sequences for d1hdgo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima}
arvaingfgrigrlvyriiyerknpdievvaindltdtktlahllkydsvhkkfpgkvey
tenslivdgkeikvfaepdpsklpwkdlgvdfviestgvfrnrekaelhlqagakkviit
apakgeditvvigcnedqlkpehtiiscasXneygysnrvvdtlelllkm

SCOP Domain Coordinates for d1hdgo1:

Click to download the PDB-style file with coordinates for d1hdgo1.
(The format of our PDB-style files is described here.)

Timeline for d1hdgo1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdgo2