SCOP 1.67: Domain d2gd1p1: 2gd1 P:0-148,P:313-333

Lineage for d2gd1p1 (2gd1 P:0-148,P:313-333)

Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (10 PDB entries)
Domain d2gd1p1: 2gd1 P:0-148,P:313-333 [29979]
Other proteins in same PDB: d2gd1o2, d2gd1p2, d2gd1q2, d2gd1r2

Details for d2gd1p1

PDB Entry: 2gd1 (more details), 2.5 Å

PDB Description: coenzyme-induced conformational changes in glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophillus

SCOP Domain Sequences for d2gd1p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gd1p1 c.2.1.3 (P:0-148,P:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d2gd1p1:

Click to download the PDB-style file with coordinates for d2gd1p1.
(The format of our PDB-style files is described here.)

Timeline for d2gd1p1: