SCOP 1.75: Domain d4dbvr1: 4dbv R:0-148,R:313-333

Lineage for d4dbvr1 (4dbv R:0-148,R:313-333)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)

8. Domain d4dbvr1: 4dbv R:0-148,R:313-333 [29977]
   Other proteins in same PDB: d4dbvo2, d4dbvp2, d4dbvq2, d4dbvr2
   complexed with ndp, so4; mutant

Details for d4dbvr1

PDB Entry: 4dbv, 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

PDB Compounds: (R:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d4dbvr1:

Sequence; same for both SEQRES and ATOM records:

>d4dbvr1 c.2.1.3 (R:0-148,R:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

Timeline for d4dbvr1:

• d4dbvr1 first appeared (with stable ids) in SCOP 1.55
  
• d4dbvr1 appears in SCOP 1.73
  
• d4dbvr1 appears in SCOPe 2.01
  
• d4dbvr1 appears in the current release, SCOPe 2.08