Lineage for d4dbvq1 (4dbv Q:0-148,Q:313-333)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175469Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
  6. 175557Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 175566Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (6 PDB entries)
  8. 175581Domain d4dbvq1: 4dbv Q:0-148,Q:313-333 [29976]
    Other proteins in same PDB: d4dbvo2, d4dbvp2, d4dbvq2, d4dbvr2

Details for d4dbvq1

PDB Entry: 4dbv (more details), 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

SCOP Domain Sequences for d4dbvq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dbvq1 c.2.1.3 (Q:0-148,Q:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d4dbvq1:

Click to download the PDB-style file with coordinates for d4dbvq1.
(The format of our PDB-style files is described here.)

Timeline for d4dbvq1: