SCOPe 2.03: Domain d2dbvp1: 2dbv P:0-148,P:313-333

Lineage for d2dbvp1 (2dbv P:0-148,P:313-333)

Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)
Domain d2dbvp1: 2dbv P:0-148,P:313-333 [29971]
Other proteins in same PDB: d2dbvo2, d2dbvp2, d2dbvq2, d2dbvr2
complexed with ndp, so4; mutant

Details for d2dbvp1

PDB Entry: 2dbv (more details), 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

PDB Compounds: (P:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2dbvp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbvp1 c.2.1.3 (P:0-148,P:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOPe Domain Coordinates for d2dbvp1:

Click to download the PDB-style file with coordinates for d2dbvp1.
(The format of our PDB-style files is described here.)

Timeline for d2dbvp1: